Recombinant Human PCDHGA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5H1

Gene Name: PCDHGA2

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Ile251

End Site: Pro560

Coverage: 0.35

Isoelectric Point: 4

Core Sequence: IPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRAKVIVTVLDVNDNAPEFYMTSATSSVSEDSLPGTIIGLFNVHDRDSGQNAFTTCSLPEDLPFKLEKSVDNYYRLVTTRALDREQFSFYNITLTAKDGGNPSLSTDAHILLQVADINDNAPAFSRTSYSTYIPENNPRGASVFSVTAHDPDSNDNAHVTYSFAEDTVQGAPLSSYISINSDTGVLYALRSFDYEQLRDLQVWVIARDSGNPPLSSNVSLSLFVLDQNDNAP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 45%, Pig - 85%, Cynomolgus monkey - 70%

Alternative gene names: /

Alternative protein names: Protocadherin gamma-A2; PCDH-gamma-A2

Protein name: protocadherin gamma subfamily A, 2

Full length: 932 amino acids

Entry name: PCDG2_HUMAN

• SKU: ASBPP-2983-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2983-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 56113