Recombinant Human PCGF2 Protein

Recombinant Human PCGF2 Protein
SKU
ASBPP-3218-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P35227

Gene Name: PCGF2

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Tyr101

End Site: Pro270

Coverage: 0.51

Isoelectric Point: 5.5

Core Sequence: YPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: MEL18; RNF110; ZNF144

Alternative protein names: Polycomb group RING finger protein 2; DNA-binding protein Mel-18; RING finger protein 110; Zinc finger protein 144

Protein name: polycomb group ring finger 2

Full length: 344 amino acids

Entry name: PCGF2_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin
More Information
SKU ASBPP-3218-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3218-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7703
Product information (PDF)
×
MSDS (PDF)
×