Note: Dry Ice fees will be extra-charged
Uniprot: Q9BYE7
Gene Name: PCGF6
Expression System: Escherichia coli
Molecular Weight: 14 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 82%
Start Site: Ala21
End Site: Pro130
Coverage: 0.33
Isoelectric Point: 4
Core Sequence: AALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTP
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 82%, Cynomolgus monkey - 97%
Alternative gene names: MBLR; RNF134
Alternative protein names: Polycomb group RING finger protein 6; Mel18 and Bmi1-like RING finger; RING finger protein 134
Protein name: polycomb group ring finger 6
Full length: 350 amino acids
Entry name: PCGF6_HUMAN
Product panel: E3 Ligase,DNA binding & Chromatin
English
Deutsch
