Recombinant Human PCNA Protein

Recombinant Human PCNA Protein
SKU
ASBPP-4382-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P12004

Gene Name: PCNA

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Ser261

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Proliferating cell nuclear antigen; PCNA; Cyclin

Protein name: proliferating cell nuclear antigen

Full length: 261 amino acids

Entry name: PCNA_HUMAN

Product panel: Autoimmune Disease,IHC Pathology,DNA binding & Chromatin
More Information
SKU ASBPP-4382-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4382-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5111
Product information (PDF)
×
MSDS (PDF)
×