Recombinant Human PDCD6IP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WUM4

Gene Name: PDCD6IP

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu561

End Site: Gln710

Coverage: 0.18

Isoelectric Point: 5.5

Core Sequence: EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: AIP1; ALIX; KIAA1375

Alternative protein names: Programmed cell death 6-interacting protein; PDCD6-interacting protein; ALG-2-interacting protein 1; ALG-2-interacting protein X; Hp95

Protein name: programmed cell death 6 interacting protein

Full length: 868 amino acids

Entry name: PDC6I_HUMAN

• SKU: ASBPP-336-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-336-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10015