Recombinant Human PDHA2 Protein

Recombinant Human PDHA2 Protein
SKU
ASBPP-4408-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P29803

Gene Name: PDHA2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Ser291

End Site: Asp370

Coverage: 0.24

Isoelectric Point: 5.5

Core Sequence: SMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 82%, Cynomolgus monkey - 92%

Alternative gene names: PDHAL

Alternative protein names: Pyruvate dehydrogenase E1 component subunit alpha; testis-specific form; mitochondrial; PDHE1-A type II

Protein name: pyruvate dehydrogenase E1 subunit alpha 2

Full length: 388 amino acids

Entry name: ODPAT_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4408-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4408-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5161
Product information (PDF)
×
MSDS (PDF)
×