Recombinant Human PGRMC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00264

Gene Name: PGRMC1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Pro51

End Site: Ser190

Coverage: 0.77

Isoelectric Point: 5

Core Sequence: PAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 82%

Alternative gene names: HPR6.6; PGRMC

Alternative protein names: Membrane-associated progesterone receptor component 1; mPR; Dap1; IZA

Protein name: progesterone receptor membrane component 1

Full length: 195 amino acids

Entry name: PGRC1_HUMAN

• SKU: ASBPP-3908-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3908-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10857