Recombinant Human PHF13 Protein

Recombinant Human PHF13 Protein
SKU
ASBPP-3815-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86YI8

Gene Name: PHF13

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser91

End Site: Gly170

Coverage: 0.30

Isoelectric Point: 10

Core Sequence: SHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: PHD finger protein 13; Survival time-associated PHD finger protein in ovarian cancer 1; SPOC1

Protein name: PHD finger protein 13

Full length: 300 amino acids

Entry name: PHF13_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3815-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3815-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 148479
Product information (PDF)
×
MSDS (PDF)
×