Recombinant Human PHF8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPP1

Gene Name: PHF8

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Lys871

End Site: Leu1050

Coverage: 0.18

Isoelectric Point: 11.5

Core Sequence: KKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRIL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1111; ZNF422

Alternative protein names: Histone lysine demethylase PHF8; PHD finger protein 8; [histone H3]-dimethyl-L-lysine(36) demethylase PHF8; [histone H3]-dimethyl-L-lysine(9) demethylase PHF8

Protein name: PHD finger protein 8

Full length: 1060 amino acids

Entry name: PHF8_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-2944-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2944-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23133