Recombinant Human PHGDH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O43175

Gene Name: PHGDH

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ile11

End Site: Lys310

Coverage: 0.58

Isoelectric Point: 6.5

Core Sequence: ISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 97%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: PGDH3

Alternative protein names: D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase

Protein name: phosphoglycerate dehydrogenase

Full length: 533 amino acids

Entry name: SERA_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4322-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4322-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 26227