Recombinant Human PIMREG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BSJ6

Gene Name: PIMREG

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Arg121

End Site: Lys230

Coverage: 0.50

Isoelectric Point: 10

Core Sequence: RKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Pig - 72%, Cynomolgus monkey - 90%

Alternative gene names: CATS; FAM64A; RCS1

Alternative protein names: Protein PIMREG; CALM-interactor expressed in thymus and spleen; PICALM-interacting mitotic regulator; Regulator of chromosome segregation protein 1

Protein name: PICALM interacting mitotic regulator

Full length: 248 amino acids

Entry name: PIMRE_HUMAN

• SKU: ASBPP-3235-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3235-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54478