Recombinant Human PITX1 Protein

Recombinant Human PITX1 Protein
SKU
ASBPP-3016-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P78337

Gene Name: PITX1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Glu41

End Site: Arg140

Coverage: 0.33

Isoelectric Point: 7

Core Sequence: EPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 90%, Pig - 96%

Alternative gene names: BFT; PTX1

Alternative protein names: Pituitary homeobox 1; Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1

Protein name: paired like homeodomain 1

Full length: 314 amino acids

Entry name: PITX1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3016-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3016-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5307
Product information (PDF)
×
MSDS (PDF)
×