Note: Dry Ice fees will be extra-charged
Uniprot: O75364
Gene Name: PITX3
Expression System: Escherichia coli
Molecular Weight: 10 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Ala21
End Site: Ser90
Coverage: 0.26
Isoelectric Point: 8
Core Sequence: AGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: PTX3
Alternative protein names: Pituitary homeobox 3; Homeobox protein PITX3; Paired-like homeodomain transcription factor 3
Protein name: paired like homeodomain 3
Full length: 302 amino acids
Entry name: PITX3_HUMAN
Product panel: Neuroscience Biomarkers,DNA binding & Chromatin
English
Deutsch
