Recombinant Human PKNOX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96KN3

Gene Name: PKNOX2

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Thr31

End Site: Leu180

Coverage: 0.33

Isoelectric Point: 6

Core Sequence: TATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: PREP2

Alternative protein names: Homeobox protein PKNOX2; Homeobox protein PREP-2; PBX/knotted homeobox 2

Protein name: PBX/knotted 1 homeobox 2

Full length: 472 amino acids

Entry name: PKNX2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10424-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10424-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 63876