Recombinant Human PLAAT3 Protein

Recombinant Human PLAAT3 Protein
SKU
ASBPP-3393-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P53816

Gene Name: PLAAT3

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Tyr21

End Site: Val130

Coverage: 0.74

Isoelectric Point: 6.5

Core Sequence: YRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 88%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: HRASLS3; HREV107; PLA2G16

Alternative protein names: Phospholipase A and acyltransferase 3; Adipose-specific phospholipase A2; AdPLA; Group XVI phospholipase A1/A2; H-rev 107 protein homolog; H-REV107; HREV107-1; HRAS-like suppressor 1; HRAS-like suppressor 3; HRSL3; HREV107-3; Renal carcinoma antigen NY-REN-65

Protein name: phospholipase A and acyltransferase 3

Full length: 162 amino acids

Entry name: PLAT3_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3393-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3393-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 11145
Product information (PDF)
×
MSDS (PDF)
×