Recombinant Human PLAG1 Protein

Recombinant Human PLAG1 Protein
SKU
ASBPP-3444-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6DJT9

Gene Name: PLAG1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu11

End Site: Lys90

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: EVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein PLAG1; Pleiomorphic adenoma gene 1 protein

Protein name: PLAG1 zinc finger

Full length: 500 amino acids

Entry name: PLAG1_HUMAN

Product panel: E3 Ligase,DNA binding & Chromatin
More Information
SKU ASBPP-3444-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3444-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5324
Product information (PDF)
×
MSDS (PDF)
×