Recombinant Human POLD4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HCU8

Gene Name: POLD4

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Met1

End Site: Leu107

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: POLDS

Alternative protein names: DNA polymerase delta subunit 4; DNA polymerase delta subunit p12

Protein name: DNA polymerase delta 4, accessory subunit

Full length: 107 amino acids

Entry name: DPOD4_HUMAN

• SKU: ASBPP-4037-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4037-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57804