Recombinant Human POLI Protein

Recombinant Human POLI Protein
SKU
ASBPP-2939-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UNA4

Gene Name: POLI

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Val531

End Site: Pro710

Coverage: 0.26

Isoelectric Point: 6

Core Sequence: VFKQLPVDIQEEILSGKSREKFQGKGSVSCPLHASRGVLSFFSKKQMQDIPINPRDHLSSSKQVSSVSPCEPGTSGFNSSSSSYMSSQKDYSYYLDNRLKDERISQGPKEPQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Pig - 81%, Cynomolgus monkey - 96%

Alternative gene names: RAD30B

Alternative protein names: DNA polymerase iota; Eta2; RAD30 homolog B

Protein name: DNA polymerase iota

Full length: 740 amino acids

Entry name: POLI_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-2939-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2939-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 11201
Product information (PDF)
×
MSDS (PDF)
×