Recombinant Human POLR2B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P30876

Gene Name: POLR2B

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Tyr811

End Site: Thr910

Coverage: 0.09

Isoelectric Point: 4.5

Core Sequence: YRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%

Alternative gene names: /

Alternative protein names: DNA-directed RNA polymerase II subunit RPB2; DNA-directed RNA polymerase II 140 kDa polypeptide; DNA-directed RNA polymerase II subunit B; RNA polymerase II subunit 2; RNA polymerase II subunit B2

Protein name: RNA polymerase II subunit B

Full length: 1174 amino acids

Entry name: RPB2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-3301-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3301-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5431