Recombinant Human POLR2G Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P62487

Gene Name: POLR2G

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ile11

End Site: Leu170

Coverage: 0.97

Isoelectric Point: 6

Core Sequence: ILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: RPB7

Alternative protein names: DNA-directed RNA polymerase II subunit RPB7; RNA polymerase II subunit B7; DNA-directed RNA polymerase II subunit G; RNA polymerase II 19 kDa subunit; RPB19

Protein name: RNA polymerase II subunit G

Full length: 172 amino acids

Entry name: RPB7_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3055-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3055-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5436