Recombinant Human POLR3E Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NVU0

Gene Name: POLR3E

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Lys411

End Site: Asp520

Coverage: 0.15

Isoelectric Point: 5

Core Sequence: KHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQSGPAGLVCGDQRIQVAKTKAQQNHALLERELQRRKEQLRVPAVPPGVRIKEEPVSEEGEEDEEQEAEEEPMD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1452

Alternative protein names: DNA-directed RNA polymerase III subunit RPC5; RNA polymerase III subunit C5; DNA-directed RNA polymerase III 80 kDa polypeptide

Protein name: RNA polymerase III subunit E

Full length: 708 amino acids

Entry name: RPC5_HUMAN

• SKU: ASBPP-3264-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3264-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55718