Recombinant Human POU3F4 Protein

Recombinant Human POU3F4 Protein
SKU
ASBPP-3424-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P49335

Gene Name: POU3F4

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asn121

End Site: Gly340

Coverage: 0.65

Isoelectric Point: 8

Core Sequence: NPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: BRN4; OTF9

Alternative protein names: POU domain; class 3; transcription factor 4; Brain-specific homeobox/POU domain protein 4; Brain-4; Brn-4; Octamer-binding protein 9; Oct-9; Octamer-binding transcription factor 9; OTF-9

Protein name: POU class 3 homeobox 4

Full length: 361 amino acids

Entry name: PO3F4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3424-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3424-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5456
Product information (PDF)
×
MSDS (PDF)
×