Recombinant Human POU6F2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78424

Gene Name: POU6F2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Thr201

End Site: Ala320

Coverage: 0.18

Isoelectric Point: 8

Core Sequence: TNQHPQPAPQAPSQSQQQPLQPTPPQQPPPASQQPPAPTSQLQQAPQPQQHQPHSHSQNQNQPSPTQQSSSPPQKPSQSPGHGLPSPLTPPNPLQLVNNPLASQAAAAAAAMSSIASSQA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: RPF1

Alternative protein names: POU domain; class 6; transcription factor 2; Retina-derived POU domain factor 1; RPF-1

Protein name: POU class 6 homeobox 2

Full length: 691 amino acids

Entry name: PO6F2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10415-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10415-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 11281