Recombinant Human PPAN Protein

Recombinant Human PPAN Protein
SKU
ASBPP-10384-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQ55

Gene Name: PPAN

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Val301

End Site: Lys420

Coverage: 0.27

Isoelectric Point: 7

Core Sequence: VSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 62%, Cynomolgus monkey - 95%

Alternative gene names: BXDC3; SSF1

Alternative protein names: Suppressor of SWI4 1 homolog; Ssf-1; Brix domain-containing protein 3; Peter Pan homolog

Protein name: peter pan homolog

Full length: 473 amino acids

Entry name: SSF1_HUMAN
More Information
SKU ASBPP-10384-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10384-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 56342
Product information (PDF)
×
MSDS (PDF)
×