Recombinant Human PPIA Protein

Recombinant Human PPIA Protein
SKU
ASBPP-343-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P62937

Gene Name: PPIA

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Glu165

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CYPA

Alternative protein names: Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A; N-terminally processed]

Protein name: peptidylprolyl isomerase A

Full length: 165 amino acids

Entry name: PPIA_HUMAN

Product panel: Neuroscience Biomarkers,Enzyme
More Information
SKU ASBPP-343-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-343-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5478
Product information (PDF)
×
MSDS (PDF)
×