Recombinant Human PPIA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P62937

Gene Name: PPIA

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Glu165

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CYPA

Alternative protein names: Peptidyl-prolyl cis-trans isomerase A; PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A; N-terminally processed]

Protein name: peptidylprolyl isomerase A

Full length: 165 amino acids

Entry name: PPIA_HUMAN

Product panel: Neuroscience Biomarkers,Enzyme

• SKU: ASBPP-343-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-343-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5478