Recombinant Human PPIE Protein

Recombinant Human PPIE Protein
SKU
ASBPP-4315-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UNP9

Gene Name: PPIE

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Val301

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 67%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: CYP33

Alternative protein names: Peptidyl-prolyl cis-trans isomerase E; PPIase E; Cyclophilin E; Cyclophilin-33; Rotamase E

Protein name: peptidylprolyl isomerase E

Full length: 301 amino acids

Entry name: PPIE_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4315-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4315-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10450
Product information (PDF)
×
MSDS (PDF)
×