Recombinant Human PPP1R14D Protein

Recombinant Human PPP1R14D Protein
SKU
ASBPP-4145-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NXH3

Gene Name: PPP1R14D

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Met1

End Site: Lys145

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 80%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: GBPI

Alternative protein names: Protein phosphatase 1 regulatory subunit 14D; Gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI-1

Protein name: protein phosphatase 1 regulatory inhibitor subunit 14D

Full length: 145 amino acids

Entry name: PP14D_HUMAN
More Information
SKU ASBPP-4145-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4145-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 54866
Product information (PDF)
×
MSDS (PDF)
×