Recombinant Human PPP1R16A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96I34

Gene Name: PPP1R16A

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Ser341

End Site: Glu480

Coverage: 0.27

Isoelectric Point: 10

Core Sequence: SAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 76%, Cynomolgus monkey - 94%

Alternative gene names: MYPT3

Alternative protein names: Protein phosphatase 1 regulatory subunit 16A; Myosin phosphatase-targeting subunit 3

Protein name: protein phosphatase 1 regulatory subunit 16A

Full length: 528 amino acids

Entry name: PP16A_HUMAN

• SKU: ASBPP-2627-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2627-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84988