Recombinant Human PPP2R3B Protein

Recombinant Human PPP2R3B Protein
SKU
ASBPP-10393-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5P8

Gene Name: PPP2R3B

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Asp331

End Site: Glu570

Coverage: 0.43

Isoelectric Point: 4.5

Core Sequence: DLLIDADDLARHNDHALSTKMIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 24%, Pig - 88%, Cynomolgus monkey - 68%

Alternative gene names: PPP2R3L

Alternative protein names: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta; PP2A subunit B isoform PR48; Protein phosphatase 2A 48 kDa regulatory subunit

Protein name: protein phosphatase 2 regulatory subunit B''beta

Full length: 575 amino acids

Entry name: P2R3B_HUMAN
More Information
SKU ASBPP-10393-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10393-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 28227
Product information (PDF)
×
MSDS (PDF)
×