Recombinant Human PPWD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96BP3

Gene Name: PPWD1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Lys411

End Site: Ala480

Coverage: 0.12

Isoelectric Point: 8

Core Sequence: KKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0073

Alternative protein names: Peptidylprolyl isomerase domain and WD repeat-containing protein 1; Spliceosome-associated cyclophilin

Protein name: peptidylprolyl isomerase domain and WD repeat containing 1

Full length: 646 amino acids

Entry name: PPWD1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3338-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3338-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23398