Recombinant Human PPY Protein

Recombinant Human PPY Protein
SKU
ASBPP-3044-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P01298

Gene Name: PPY

Expression System: Escherichia coli

Molecular Weight: 8.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Pro31

End Site: Leu90

Coverage: 0.69

Isoelectric Point: 7

Core Sequence: PLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPREL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 80%, Cynomolgus monkey - 98%

Alternative gene names: PNP

Alternative protein names: Pancreatic polypeptide prohormone; PH; Pancreatic polypeptide Y; Obinepitide) [Cleaved into: Pancreatic polypeptide; HPP; PP; Pancreatic icosapeptide; PI]

Protein name: pancreatic polypeptide

Full length: 95 amino acids

Entry name: PAHO_HUMAN
More Information
SKU ASBPP-3044-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3044-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5539
Product information (PDF)
×
MSDS (PDF)
×