Recombinant Human Peroxiredoxin-4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13162

Gene Name: PRDX4

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp71

End Site: Pro260

Coverage: 0.83

Isoelectric Point: 6.5

Core Sequence: DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Peroxiredoxin-4; Antioxidant enzyme AOE372; AOE37-2; Peroxiredoxin IV; Prx-IV; Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372; Thioredoxin-dependent peroxiredoxin 4

Protein name: peroxiredoxin 4

Full length: 271 amino acids

Entry name: PRDX4_HUMAN

Product panel: Enzyme

• SKU: ASBPP-418-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-418-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10549