Recombinant Human PRG4 Protein

Recombinant Human PRG4 Protein
SKU
ASBPP-348-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92954

Gene Name: PRG4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Pro1031

End Site: Arg1110

Coverage: 0.05

Isoelectric Point: 11

Core Sequence: PTSTKKPKTMPRVRKPKTTPTPRKMTSTMPELNPTSRIAEAMLQTTTRPNQTPNSKLVEVNPKSEDAGGAEGETPHMLLR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Pig - 58%, Cynomolgus monkey - 88%

Alternative gene names: MSF; SZP

Alternative protein names: Proteoglycan 4; Lubricin; Megakaryocyte-stimulating factor; Superficial zone proteoglycan) [Cleaved into: Proteoglycan 4 C-terminal part]

Protein name: proteoglycan 4

Full length: 1404 amino acids

Entry name: PRG4_HUMAN
More Information
SKU ASBPP-348-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-348-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10216
Product information (PDF)
×
MSDS (PDF)
×