Recombinant Human PRKAG3 Protein

Recombinant Human PRKAG3 Protein
SKU
ASBPP-4159-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGI9

Gene Name: PRKAG3

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 68%

Start Site: Arg11

End Site: Glu190

Coverage: 0.40

Isoelectric Point: 5

Core Sequence: RTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Pig - 69%, Cynomolgus monkey - 90%

Alternative gene names: AMPKG3

Alternative protein names: 5'-AMP-activated protein kinase subunit gamma-3; AMPK gamma3; AMPK subunit gamma-3

Protein name: protein kinase AMP-activated non-catalytic subunit gamma 3

Full length: 489 amino acids

Entry name: AAKG3_HUMAN
More Information
SKU ASBPP-4159-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4159-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 53632
Product information (PDF)
×
MSDS (PDF)
×