Recombinant Human PRKCQ Protein

Recombinant Human PRKCQ Protein
SKU
ASBPP-3225-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q04759

Gene Name: PRKCQ

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Gly581

End Site: Gly700

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: GQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: PRKCT

Alternative protein names: Protein kinase C theta type; nPKC-theta

Protein name: protein kinase C theta

Full length: 706 amino acids

Entry name: KPCT_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3225-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3225-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5588
Product information (PDF)
×
MSDS (PDF)
×