Recombinant Human PROX2 Protein

Recombinant Human PROX2 Protein
SKU
ASBPP-3426-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q3B8N5

Gene Name: PROX2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Ala21

End Site: Arg100

Coverage: 0.15

Isoelectric Point: 8

Core Sequence: ACTEGERSSSPPELDRDSPFPWSQVPSSSPTDPEWFGDEHIQAKRARVETIVRGMCLSPNPLVPGNAQAGVSPRCPKKAR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Pig - 73%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Prospero homeobox protein 2; Homeobox prospero-like protein PROX2; PROX-2

Protein name: prospero homeobox 2

Full length: 592 amino acids

Entry name: PROX2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3426-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3426-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 283571
Product information (PDF)
×
MSDS (PDF)
×