Recombinant Human PRR13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZ81

Gene Name: PRR13

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: His61

End Site: Ser140

Coverage: 0.60

Isoelectric Point: 10.5

Core Sequence: HPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSS

Homologies: Highest protein sequence identity to the following orthologs: Pig - 69%

Alternative gene names: TXR1

Alternative protein names: Proline-rich protein 13; Taxane-resistance protein

Protein name: proline rich 13

Full length: 148 amino acids

Entry name: PRR13_HUMAN

• SKU: ASBPP-3410-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3410-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54458