Recombinant Human PRRX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P54821

Gene Name: PRRX1

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg11

End Site: Asp80

Coverage: 0.33

Isoelectric Point: 5

Core Sequence: RQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: PMX1

Alternative protein names: Paired mesoderm homeobox protein 1; Homeobox protein PHOX1; Paired-related homeobox protein 1; PRX-1

Protein name: paired related homeobox 1

Full length: 245 amino acids

Entry name: PRRX1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-314-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-314-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5396