Recombinant Human PRRX2 Protein

Recombinant Human PRRX2 Protein
SKU
ASBPP-369-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99811

Gene Name: PRRX2

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Cys31

End Site: Asp130

Coverage: 0.40

Isoelectric Point: 10

Core Sequence: CAQARKNFSVSHLLDLEEVAAAGRLAARPGARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 58%, Pig - 97%, Cynomolgus monkey - 95%

Alternative gene names: PMX2; PRX2

Alternative protein names: Paired mesoderm homeobox protein 2; Paired-related homeobox protein 2; PRX-2

Protein name: paired related homeobox 2

Full length: 253 amino acids

Entry name: PRRX2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-369-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-369-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51450
Product information (PDF)
×
MSDS (PDF)
×