Recombinant Human PRSS3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35030

Gene Name: PRSS3

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Ile81

End Site: Ser304

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 78%, Pig - 80%, Cynomolgus monkey - 90%

Alternative gene names: PRSS4; TRY3; TRY4

Alternative protein names: Trypsin-3; Brain trypsinogen; Mesotrypsin; Mesotrypsinogen; Serine protease 3; Serine protease 4; Trypsin III; Trypsin IV

Protein name: serine protease 3

Full length: 304 amino acids

Entry name: TRY3_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3062-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3062-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5646