Note: Dry Ice fees will be extra-charged
Uniprot: P24158
Gene Name: PRTN3
Expression System: Escherichia coli
Molecular Weight: 37 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: N-SUMO & C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 68%
Start Site: Ala26
End Site: Arg249
Coverage: 1.00
Isoelectric Point: 7
Core Sequence: AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 68%, Rat - 39%, Pig - 73%, Cynomolgus monkey - 46%
Alternative gene names: MBN
Alternative protein names: Myeloblastin; AGP7; C-ANCA antigen; Leukocyte proteinase 3; PR-3; PR3; Neutrophil proteinase 4; NP-4; P29; Wegener autoantigen
Protein name: proteinase 3
Full length: 256 amino acids
Entry name: PRTN3_HUMAN
Product panel: Autoimmune Disease,Enzyme
English
Deutsch
