Recombinant Human PTCD2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WV60

Gene Name: PTCD2

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Leu91

End Site: Phe310

Coverage: 0.58

Isoelectric Point: 7.5

Core Sequence: LKGELITLLHLCESRDHVELAKNVIYRYHAENKNFTLGEYKFGPLFVRLCYELDLEESAVELMKDQHLRGFFSDSTSFNILMDMLFIKGKYKSALQVLIEMKNQDVKFTKDTYVLAFAICYKLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLKNAAEGNLSKFVKRHVF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 85%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Pentatricopeptide repeat-containing protein 2; mitochondrial

Protein name: pentatricopeptide repeat domain 2

Full length: 388 amino acids

Entry name: PTCD2_HUMAN

• SKU: ASBPP-338-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-338-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79810