Recombinant Human PYHIN1 Protein

Recombinant Human PYHIN1 Protein
SKU
ASBPP-10388-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6K0P9

Gene Name: PYHIN1

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Leu11

End Site: Arg160

Coverage: 0.32

Isoelectric Point: 10

Core Sequence: LKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Pig - 43%, Cynomolgus monkey - 93%

Alternative gene names: IFIX

Alternative protein names: Pyrin and HIN domain-containing protein 1; Interferon-inducible protein X

Protein name: pyrin and HIN domain family member 1

Full length: 492 amino acids

Entry name: IFIX_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10388-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10388-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 149628
Product information (PDF)
×
MSDS (PDF)
×