Note: Dry Ice fees will be extra-charged
Uniprot: P51148
Gene Name: RAB5C
Expression System: Escherichia coli
Molecular Weight: 24.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Met1
End Site: Asn216
Coverage: 1.00
Isoelectric Point: 8.5
Core Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 87%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: RABL
Alternative protein names: Ras-related protein Rab-5C; L1880; RAB5L
Protein name: RAB5C, member RAS oncogene family
Full length: 216 amino acids
Entry name: RAB5C_HUMAN
Product panel: Enzyme