Recombinant Human RAB5C Protein

Recombinant Human RAB5C Protein
SKU
ASBPP-3877-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51148

Gene Name: RAB5C

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Asn216

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 87%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: RABL

Alternative protein names: Ras-related protein Rab-5C; L1880; RAB5L

Protein name: RAB5C, member RAS oncogene family

Full length: 216 amino acids

Entry name: RAB5C_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3877-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3877-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5878
Product information (PDF)
×
MSDS (PDF)
×