Recombinant Human RAD51B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15315

Gene Name: RAD51B

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Val41

End Site: Ser290

Coverage: 0.67

Isoelectric Point: 6

Core Sequence: VTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: RAD51L1; REC2

Alternative protein names: DNA repair protein RAD51 homolog 2; R51H2; RAD51 homolog B; Rad51B; RAD51-like protein 1

Protein name: RAD51 paralog B

Full length: 384 amino acids

Entry name: RA51B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3656-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3656-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5890