Recombinant Human RAD52 Protein

Recombinant Human RAD52 Protein
SKU
ASBPP-3654-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P43351

Gene Name: RAD52

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Pro291

End Site: Met410

Coverage: 0.30

Isoelectric Point: 5.5

Core Sequence: PPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Pig - 41%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: DNA repair protein RAD52 homolog

Protein name: RAD52 homolog, DNA repair protein

Full length: 418 amino acids

Entry name: RAD52_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3654-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3654-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5893
Product information (PDF)
×
MSDS (PDF)
×