Recombinant Human RAD54L2 Protein

Recombinant Human RAD54L2 Protein
SKU
ASBPP-2966-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4B4

Gene Name: RAD54L2

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Pro81

End Site: Arg280

Coverage: 0.14

Isoelectric Point: 5.5

Core Sequence: PSEQLRRHQGKNLASEDPKKKRAQKPSHMRRNIRKLLREDQLEPVTKAAQQEELERRKRLEQQRKDYAAPIPTVPLEFLPEEIALRASDGPQLPPRVLAQEVICLDSSSGSEDEKSSRDEVIELSSGEEDTLHIVDSSESVSEDDEEEEKGGTHVNDVLNQRDALGRVLVNLNHPPEEENVFLAPQLARAVKPHQIGGIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: ARIP4; KIAA0809

Alternative protein names: Helicase ARIP4; Androgen receptor-interacting protein 4; RAD54-like protein 2

Protein name: RAD54 like 2

Full length: 1467 amino acids

Entry name: ARIP4_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-2966-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2966-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23132
Product information (PDF)
×
MSDS (PDF)
×