Recombinant Human RAF1 Protein

Recombinant Human RAF1 Protein
SKU
ASBPP-4355-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P04049

Gene Name: RAF1

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ser211

End Site: Tyr340

Coverage: 0.21

Isoelectric Point: 10.5

Core Sequence: SLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: RAF

Alternative protein names: RAF proto-oncogene serine/threonine-protein kinase; Proto-oncogene c-RAF; cRaf; Raf-1

Protein name: Raf-1 proto-oncogene, serine/threonine kinase

Full length: 648 amino acids

Entry name: RAF1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4355-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4355-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5894
Product information (PDF)
×
MSDS (PDF)
×